RP11-217H1.1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1

Key Reference: Shibatani,T., (2005) Biochemistry 44 (16), 5982-5992

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ56344, highly similar to Implantation-associated protein EMBL BAG58019.1

Protein Size: 367

Purification: Affinity Purified

• SKU: AVIARP58725_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58725_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84061
• Host: Rabbit
• Conjugate: Conjugated, FITC