RPS6KB1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1

Key Reference: Ma,X.M., (2008) Cell 133 (2), 303-313

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase beta-1

Protein Size: 525

Purification: Affinity Purified

• SKU: AVIARP56554_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56554_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6198
• Host: Rabbit