RUBCN Antibody - middle region : FITC

RUBCN Antibody - middle region : FITC
SKU
AVIARP58950_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0226

Molecular Weight: 103kDa

Peptide Sequence: Synthetic peptide located within the following region: DQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: run domain Beclin-1-interacting and cysteine-rich domain-containing protein

Protein Size: 927

Purification: Affinity Purified
More Information
SKU AVIARP58950_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58950_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9711
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×