S100A9 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human S100A9

Key Reference: Ghavami,S., (2008) Biochim. Biophys. Acta 1783 (2), 297-311

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein S100-A9

Protein Size: 114

Purification: Affinity Purified

• SKU: AVIARP56533_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56533_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 6280
• Host: Rabbit