SCP2 Antibody - N-terminal region : FITC

SCP2 Antibody - N-terminal region : FITC
SKU
AVIARP56537_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-specific lipid-transfer protein Ensembl ENSP00000360564

Protein Size: 503

Purification: Affinity Purified
More Information
SKU AVIARP56537_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56537_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6342
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×