SERHL2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEHL2

Key Reference: N/A

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine hydrolase-like protein 2

Protein Size: 314

Purification: Affinity purified

• SKU: AVIARP58657_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58657_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 253190
• Host: Rabbit
• Conjugate: Conjugated, Biotin