SERPINB9 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPB9

Molecular Weight: 41 kDa

Peptide Sequence: Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serpin B9

Protein Size: 376

Purification: Affinity purified

• SKU: AVIARP59175_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59175_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5272
• Host: Rabbit
• Conjugate: Conjugated, FITC