SERPINI2 Antibody - middle region : FITC

SERPINI2 Antibody - middle region : FITC
SKU
AVIARP56686_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation, fibrinolysis, development, malignancy and inflammation. The gene product may have a role in a growth-control, possibly growth-suppressing pathway and, when impaired, may be involved in pancreatic carcinogenesis. The protein is a member of the plasminogen activator inhibitor-1 family, a subset of the serpin superfamily whose members act as tissue-specific tPA inhibitors. Two alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI2

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin I2

Protein Size: 405

Purification: Affinity Purified
More Information
SKU AVIARP56686_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56686_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5276
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×