SERPINI2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation, fibrinolysis, developmen

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serpin I2

Protein Size: 405

Purification: Affinity Purified

• SKU: AVIARP56685_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56685_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5276
• Host: Rabbit