SH3BP2 Antibody - middle region : FITC

SH3BP2 Antibody - middle region : FITC
SKU
AVIARP56546_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3BP2

Key Reference: Idowu,B.D., (2008) Br J Oral Maxillofac Surg 46 (3), 229-230

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 2

Protein Size: 561

Purification: Affinity Purified
More Information
SKU AVIARP56546_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56546_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6452
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×