Sh3gl3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sh3gl3 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endophilin-A3

Protein Size: 347

Purification: Affinity Purified

• SKU: AVIARP56551_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56551_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 20408
• Host: Rabbit