SLC25A6 Antibody - N-terminal region : Biotin

SLC25A6 Antibody - N-terminal region : Biotin
SKU
AVIARP58528_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A6

Key Reference: Yang,Z., (2007) Mol. Biol. Cell 18 (11), 4681-4689

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 3

Protein Size: 298

Purification: Affinity Purified
More Information
SKU AVIARP58528_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58528_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 293
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×