SLC25A6 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A6

Key Reference: Yang,Z., (2007) Mol. Biol. Cell 18 (11), 4681-4689

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP/ATP translocase 3

Protein Size: 298

Purification: Affinity Purified

• SKU: AVIARP58528_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58528_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 293
• Host: Rabbit
• Conjugate: Conjugated, HRP