SLFN12 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLFN12

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Schlafen family member 12

Protein Size: 578

Purification: Affinity Purified

• SKU: AVIARP57096_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57096_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55106
• Host: Rabbit