SLIT3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3

Key Reference: Lin,L. (2006) Stem Cells 24 (11), 2504-2513

Molecular Weight: 168kDa

Peptide Sequence: Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Slit homolog 3 protein

Protein Size: 1523

Purification: Affinity Purified

• SKU: AVIARP58766_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58766_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6586
• Host: Rabbit
• Conjugate: Conjugated, HRP