SPACA4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPACA4 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm acrosome membrane-associated protein 4

Protein Size: 124

Purification: Affinity Purified

• SKU: AVIARP58662_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58662_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 171169
• Host: Rabbit
• Conjugate: Conjugated, FITC