SPTAN1 Antibody - N-terminal region : Biotin

SPTAN1 Antibody - N-terminal region : Biotin
SKU
AVIARP58532_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 272kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spectrin alpha chain, non-erythrocytic 1

Protein Size: 2472

Purification: Affinity Purified
More Information
SKU AVIARP58532_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58532_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 6709
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×