SPTAN1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 272kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spectrin alpha chain, non-erythrocytic 1

Protein Size: 2472

Purification: Affinity Purified

• SKU: AVIARP58532_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58532_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Immunoprecipitation, Western Blotting, Immunohistochemistry
• Human Gene ID: 6709
• Host: Rabbit
• Conjugate: Conjugated, FITC