SPTAN1 Antibody - N-terminal region : HRP

SPTAN1 Antibody - N-terminal region : HRP
SKU
AVIARP58532_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 272kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spectrin alpha chain, non-erythrocytic 1

Protein Size: 2472

Purification: Affinity Purified
More Information
SKU AVIARP58532_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58532_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 6709
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×