STIMATE Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM110

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: store-operated calcium entry regulator STIMATE

Protein Size: 294

Purification: Affinity Purified

• SKU: AVIARP55905_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55905_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 375346
• Host: Rabbit