STK11 Antibody - C-terminal region : FITC

STK11 Antibody - C-terminal region : FITC
SKU
AVIARP58959_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STK11

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: EAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase STK11

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP58959_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58959_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6794
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×