STK17A Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK17A

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 17A

Protein Size: 414

Purification: Affinity Purified

• SKU: AVIARP58888_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58888_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9263
• Host: Rabbit
• Conjugate: Conjugated, FITC