Tau-383 (0N4R) Wild-Type Pre-formed Fibrils

Human Recombinant Tau-383 (0N4R) Wild-Type Pre-formed Fibrils
SKU
STRSPR-510B
Packaging Unit
100 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: Tau-383 (0N4R)

Nature: Recombinant

Swiss-Prot: P10636-6

Expression System: E. coli

Protein Length: 383 aa

Amino Acid Sequence: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Purification: Ion-exchange Purified

Purity: >95% as per SDS-PAGE, >80% as per A260/A280

Storage Buffer: 10mM Hepes pH 7.4, 100mM NaCl

Protein Size: 40.007 kDa

Conjugate: No Tag

Scientific Background: Several tau isoforms, including 0N4R, are expressed in the human brain, and the existence of multiple human tauopathies with distinct fibril morphologies suggests different molecular conformers incorporating different isoforms may exist (1, 2). NMR data indicates that both 3R and 4R tau are incorporated into AD-tau seeded fibrils (3).

References: 1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273(89)90210-92. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-0311533. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-510B
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-510B
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Reactivity Human
Application Western Blotting, SDS-PAGE
Product information (PDF) Download
MSDS (PDF) Download