TBC1D10C Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D10C

Key Reference: Pan,F., (2007) Nature 445 (7126), 433-436

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carabin

Protein Size: 446

Purification: Affinity Purified

• SKU: AVIARP55893_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55893_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 374403
• Host: Rabbit