TBC1D14 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14

Key Reference: Tempel,W., (2008) Proteins 71 (1), 497-502

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 14

Protein Size: 693

Purification: Affinity Purified

• SKU: AVIARP56315_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56315_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57533
• Host: Rabbit