TEX11 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TEX11

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: SLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 11 protein

Protein Size: 615

Purification: Affinity Purified

• SKU: AVIARP56160_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56160_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56159
• Host: Rabbit