Tfam Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor A, mitochondrial

Protein Size: 243

Purification: Affinity Purified

• SKU: AVIARP58723_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58723_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 21780
• Host: Rabbit
• Conjugate: Conjugated, HRP