TGFB3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TGFB3 is involved in embryogenesis and cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transforming growth factor beta-3

Protein Size: 412

Purification: Affinity Purified

• SKU: AVIARP59157_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59157_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7043
• Host: Rabbit
• Conjugate: Conjugated, Biotin