Thap11 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: THAP domain-containing protein 11

Protein Size: 305

Purification: Affinity Purified

• SKU: AVIARP58803_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58803_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 59016
• Host: Rabbit
• Conjugate: Conjugated, Biotin