THPO Antibody - middle region : FITC

THPO Antibody - middle region : FITC
SKU
AVIARP58735_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THPO

Key Reference: Baker,J.E., (2008) Cardiovasc. Res. 77 (1), 44-53

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thrombopoietin

Protein Size: 353

Purification: Affinity Purified
More Information
SKU AVIARP58735_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58735_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7066
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×