TIMP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TIMP1

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TIMP metallopeptidase inhibitor 1 EMBL CAI42465.1

Protein Size: 207

Purification: Affinity Purified

• SKU: AVIARP59178_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59178_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7076
• Host: Rabbit
• Conjugate: Conjugated, Biotin