TIMP3 Antibody - N-terminal region : Biotin

TIMP3 Antibody - N-terminal region : Biotin
SKU
AVIARP59183_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP3

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Metalloproteinase inhibitor 3

Protein Size: 211

Purification: Affinity Purified
More Information
SKU AVIARP59183_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59183_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7078
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×