TINF2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINF2

Key Reference: Kim,S.H., (2008) J. Cell Biol. 181 (3), 447-460

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TERF1-interacting nuclear factor 2

Protein Size: 451

Purification: Affinity Purified

• SKU: AVIARP58338_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58338_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26277
• Host: Rabbit
• Conjugate: Conjugated, Biotin