TLK2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The Tousled-like kinases, first described in Arabidopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase tousled-like 2

Protein Size: 718

Purification: Affinity Purified

• SKU: AVIARP58343_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58343_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11011
• Host: Rabbit
• Conjugate: Conjugated, HRP