TLR2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLR2

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Toll-like receptor 2

Protein Size: 784

Purification: Affinity Purified

• SKU: AVIARP59037_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59037_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7097
• Host: Rabbit