TMED10 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMED10 is involved in vesicular protein trafficking.This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking. The protein is also a member of a heteromeric secretase complex and regulates the complex's gamma-secretase activity without affecting its epsilon-secretase activity. Mutations in this gene have been associated with early-onset familial Alzheimer's disease. This gene has a pseudogene on chromosome 8.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED10

Key Reference: Dolcini,V., (2008) Biochem. Biophys. Res. Commun. 371 (1), 69-74

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane emp24 domain-containing protein 10

Protein Size: 219

Purification: Affinity Purified

• SKU: AVIARP58728_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58728_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10972
• Host: Rabbit
• Conjugate: Conjugated, HRP