Tmem102 Antibody - N-terminal region : HRP

Tmem102 Antibody - N-terminal region : HRP
SKU
AVIARP55772_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane protein 102

Protein Size: 509

Purification: Affinity Purified
More Information
SKU AVIARP55772_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55772_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 380705
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×