TMEM166 antibody

Calculated MW: 17

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.

Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: Q9H8M9

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: eva-1 homolog A, regulator of programmed cell death

• SKU: GTX04091-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04091-100
• Green Labware: No
• Package Unit: 100 μg
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Flow Cytometry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 84141
• Host: Rabbit