Tmem173 Antibody - C-terminal region : Biotin

Tmem173 Antibody - C-terminal region : Biotin
SKU
AVIARP59031_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial transmembrane protein 173 EMBL AEM66211.1

Protein Size: 379

Purification: Affinity Purified
More Information
SKU AVIARP59031_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59031_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 498840
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×