TPD52L3 Antibody - middle region : Biotin

TPD52L3 Antibody - middle region : Biotin
SKU
AVIARP58727_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact functions of TPD52L3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3

Key Reference: Cao,Q., (2006) Biochem. Biophys. Res. Commun. 344 (3), 798-806

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein D55

Protein Size: 136

Purification: Affinity Purified
More Information
SKU AVIARP58727_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58727_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 89882
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×