TRIB3 Antibody - N-terminal region : Biotin

TRIB3 Antibody - N-terminal region : Biotin
SKU
AVIARP57517_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TRIB3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tribbles homolog 3

Protein Size: 385

Purification: Affinity Purified
More Information
SKU AVIARP57517_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57517_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Sheep (Ovine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57761
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×