TRIB3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tribbles homolog 3

Protein Size: 358

Purification: Affinity Purified

• SKU: AVIARP57518_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57518_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57761
• Host: Rabbit