TSTA3 Antibody - N-terminal region : FITC

TSTA3 Antibody - N-terminal region : FITC
SKU
AVIARP58679_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSTA3

Key Reference: Roos,C., (2002) J. Biol. Chem. 277 (5), 3168-3175

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GDP-L-fucose synthase

Protein Size: 321

Purification: Affinity Purified
More Information
SKU AVIARP58679_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58679_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7264
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×