TUFM Antibody - middle region : FITC

TUFM Antibody - middle region : FITC
SKU
AVIARP58546_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUFM

Key Reference: Valente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongation factor Tu, mitochondrial

Protein Size: 455

Purification: Affinity Purified
More Information
SKU AVIARP58546_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58546_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7284
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×