TUFM Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUFM

Key Reference: Valente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Elongation factor Tu, mitochondrial

Protein Size: 455

Purification: Affinity Purified

• SKU: AVIARP58546_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58546_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7284
• Host: Rabbit
• Conjugate: Conjugated, HRP