TWF1 Antibody - N-terminal region : FITC

TWF1 Antibody - N-terminal region : FITC
SKU
AVIARP56487_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TWF1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 384

Purification: Affinity Purified
More Information
SKU AVIARP56487_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56487_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5756
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×