TXNDC4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4

Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endoplasmic reticulum resident protein 44

Protein Size: 406

Purification: Affinity Purified

• SKU: AVIARP58726_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58726_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23071
• Host: Rabbit
• Conjugate: Conjugated, HRP