TXNDC5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. This gene can be co-transcribed with the upstream gene MU.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC5

Key Reference: Wang,Y., (2007) Exp. Biol. Med. (Maywood) 232 (9), 1152-1159

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin domain-containing protein 5

Protein Size: 432

Purification: Affinity Purified

• SKU: AVIARP58547_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58547_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81567
• Host: Rabbit
• Conjugate: Conjugated, Biotin