UCHL1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1

Protein Size: 223

Purification: Affinity Purified

• SKU: AVIARP58968_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58968_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7345
• Host: Rabbit
• Conjugate: Conjugated, HRP