UCHL3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UCHL3

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L3

Protein Size: 230

Purification: Affinity Purified

• SKU: AVIARP58689_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58689_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7347
• Host: Rabbit
• Conjugate: Conjugated, FITC